PDB entry 2jrx

View 2jrx on RCSB PDB site
Description: Solution NMR structure of protein YejL from E. coli. Northeast Structural Genomics target ER309
Class: structural genomics, unknown function
Keywords: homodimer, alpha helix, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2007-06-29, released 2007-08-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: UPF0352 protein yejL
  Species: Escherichia coli [TaxId:83333]
  Gene: yejL, b2187, JW2175
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AD24 (0-74)
    • cloning artifact (75-82)
  Domains in SCOPe 2.08: d2jrxa1, d2jrxa2
• Chain 'B':
  Compound: UPF0352 protein yejL
  Species: Escherichia coli [TaxId:83333]
  Gene: yejL, b2187, JW2175
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AD24 (0-74)
    • cloning artifact (75-82)
  Domains in SCOPe 2.08: d2jrxb2, d2jrxb3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2jrxA (A:)
  mpqisrysdeqveqllaellnvlekhkaptdlslmvlgnmvtnlintsiapaqrqaians
  faralqssinedkahlehhhhhh
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2jrxB (B:)
  mpqisrysdeqveqllaellnvlekhkaptdlslmvlgnmvtnlintsiapaqrqaians
  faralqssinedkahlehhhhhh