PDB entry 2jrh

View 2jrh on RCSB PDB site
Description: Solution sturcture of human MEKK3 PB1 domain cis isomer
Class: transferase
Keywords: kinase signaling domain, TRANSFERASE
Deposited on 2007-06-26, released 2007-07-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase kinase kinase 3
    Species: Homo sapiens [TaxId:9606]
    Gene: MAP3K3, MAPKKK3, MEKK3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99759 (1-85)
      • cloning artifact (86-93)
    Domains in SCOPe 2.06: d2jrha1, d2jrha2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2jrhA (A:)
mqsdvrikfehngerriiafsrpvkyedvehkvttvfgqpldlhymnnelsillknqddl
dkaidildrsssmkslrilllsqdrnlehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >2jrhA (A:)
qsdvrikfehngerriiafsrpvkyedvehkvttvfgqpldlhymnnelsillknqddld
kaidildrsssmkslrilllsqdrnlehhhhhh