PDB entry 2jr8

View 2jr8 on RCSB PDB site
Description: Solution structure of Manduca sexta moricin
Class: antimicrobial protein
Keywords: antimicrobial peptide, ANTIMICROBIAL PROTEIN
Deposited on 2007-06-21, released 2008-03-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-19, with a file datestamp of 2020-02-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Antimicrobial peptide moricin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2jr8a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jr8A (A:)
    gkipvkaikqagkvigkglrainiagtthdvvsffrpkkkkh