PDB entry 2jr5

View 2jr5 on RCSB PDB site
Description: Solution structure of UPF0350 protein VC_2471. Northeast Structural Genomics Target VcR36
Class: structural genomics, unknown function
Keywords: UPF0350 protein VC_2471, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2007-06-20, released 2007-07-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-01-30, with a file datestamp of 2013-01-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UPF0350 protein VC_2471
    Species: Vibrio cholerae [TaxId:666]
    Gene: VC_2471
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KPA2 (0-85)
      • cloning artifact (86-93)
    Domains in SCOPe 2.05: d2jr5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jr5A (A:)
    mytaeqkarikwacrrgmleldvvimpffeecfdslteseqddfvallesddpdlfawvm
    ghgrcenlglaamvdkivahnlskvrlehhhhhh