PDB entry 2jr5

View 2jr5 on RCSB PDB site
Description: Solution structure of UPF0350 protein VC_2471. Northeast Structural Genomics Target VcR36
Class: structural genomics, unknown function
Keywords: UPF0350 protein VC_2471, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2007-06-20, released 2007-07-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-19, with a file datestamp of 2020-02-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: UPF0350 protein VC_2471
  Species: Vibrio cholerae [TaxId:666]
  Gene: VC_2471
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9KPA2 (0-85)
    • cloning artifact (86-93)
  Domains in SCOPe 2.08: d2jr5a1, d2jr5a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2jr5A (A:)
  mytaeqkarikwacrrgmleldvvimpffeecfdslteseqddfvallesddpdlfawvm
  ghgrcenlglaamvdkivahnlskvrlehhhhhh