PDB entry 2jr2

View 2jr2 on RCSB PDB site
Description: Solution NMR structure of homodimer CPS_2611 from Colwellia psychrerythraea. Northeast Structural Genomics Consortium target CsR4.
Class: structural genomics, unknown function
Keywords: dimer, all alpha helix, homodimer, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2007-06-19, released 2007-07-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-19, with a file datestamp of 2020-02-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UPF0352 protein CPS_2611
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_2611
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q481E4 (0-67)
      • cloning artifact (68-75)
    Domains in SCOPe 2.08: d2jr2a2, d2jr2a3
  • Chain 'B':
    Compound: UPF0352 protein CPS_2611
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_2611
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q481E4 (0-67)
      • cloning artifact (68-75)
    Domains in SCOPe 2.08: d2jr2b2, d2jr2b3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2jr2A (A:)
mpivskysnervekiiqdlldvlvkeevtpdlalmclgnavtniiaqvpeskrvavvdnf
tkalkqsvlehhhhhh

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2jr2B (B:)
mpivskysnervekiiqdlldvlvkeevtpdlalmclgnavtniiaqvpeskrvavvdnf
tkalkqsvlehhhhhh