PDB entry 2jqn

View 2jqn on RCSB PDB site
Description: Solution NMR structure of CC0527 from Caulobacter crescentus. Northeast Structural Genomics Target CCR55
Class: structural genomics
Keywords: solution NMR structure, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG
Deposited on 2007-06-05, released 2007-07-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-19, with a file datestamp of 2020-02-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Caulobacter vibrioides [TaxId:155892]
    Gene: CC0527
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9AAR9 (0-113)
      • cloning artifact (114-115)
    Domains in SCOPe 2.08: d2jqna2, d2jqna3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jqnA (A:)
    mtliykilsraewdaakaqgrfegsavdladgfihlsageqaqetaakwfrgqanlvlla
    veaeplgedlkweasrggarfphlyrpllvsevtreadldldadgvpqlgdhlalehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jqnA (A:)
    mtliykilsraewdaakaqgrfegsavdladgfihlsageqaqetaakwfrgqanlvlla
    veaeplgedlkweasrggarfphlyrpllvsevtreadldldadgvpqlgdhlale