PDB entry 2jqn

View 2jqn on RCSB PDB site
Description: Solution NMR structure of CC0527 from Caulobacter crescentus. Northeast Structural Genomics Target CCR55
Class: structural genomics
Keywords: solution NMR structure, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG
Deposited on 2007-06-05, released 2007-07-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-19, with a file datestamp of 2020-02-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein
  Species: Caulobacter vibrioides [TaxId:155892]
  Gene: CC0527
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9AAR9 (0-113)
    • cloning artifact (114-115)
  Domains in SCOPe 2.08: d2jqna2, d2jqna3

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2jqnA (A:)
  mtliykilsraewdaakaqgrfegsavdladgfihlsageqaqetaakwfrgqanlvlla
  veaeplgedlkweasrggarfphlyrpllvsevtreadldldadgvpqlgdhlalehhhh
  hh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2jqnA (A:)
  mtliykilsraewdaakaqgrfegsavdladgfihlsageqaqetaakwfrgqanlvlla
  veaeplgedlkweasrggarfphlyrpllvsevtreadldldadgvpqlgdhlale