PDB entry 2jqk

View 2jqk on RCSB PDB site
Description: VPS4B MIT-CHMP2B Complex
Class: protein transport
Keywords: CHMP2B, VPS4B MIT, Complex, Four Helix Bundle, PROTEIN TRANSPORT
Deposited on 2007-06-02, released 2007-10-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vacuolar protein sorting-associating protein 4B
    Species: Homo sapiens [TaxId:9606]
    Gene: VPS4B, SKD1, VPS42
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2jqka_
  • Chain 'B':
    Compound: Charged multivesicular body protein 2b
    Species: Homo sapiens [TaxId:9606]
    Gene: CHMP2B
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2jqkA (A:)
ghmmsstspnlqkaidlaskaaqedkagnyeealqlyqhavqyflhvvkyeaqgdkakqs
irakcteyldraeklkeylknkekkaqkp

    Sequence, based on observed residues (ATOM records): (download) 
    >2jqkA (A:)
nlqkaidlaskaaqedkagnyeealqlyqhavqyflhvvkyeaqgdkakqsirakcteyl
draeklkeylkn

  • Chain 'B':
    No sequence available.