PDB entry 2jqh

View 2jqh on RCSB PDB site
Description: vps4b mit
Class: protein transport
Keywords: VPS4B, MIT, Three Helix Bundle, PROTEIN TRANSPORT
Deposited on 2007-06-01, released 2007-10-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vacuolar protein sorting-associating protein 4B
    Species: Homo sapiens [TaxId:9606]
    Gene: VPS4B, SKD1, VPS42
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2jqha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jqhA (A:)
    ghmmsstspnlqkaidlaskaaqedkagnyeealqlyqhavqyflhvvkyeaqgdkakqs
    irakcteyldraeklkeylknkekkaqkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jqhA (A:)
    nlqkaidlaskaaqedkagnyeealqlyqhavqyflhvvkyeaqgdkakqsirakcteyl
    draeklkeylkn