PDB entry 2jpt
View 2jpt on RCSB PDB site
Description: Structural changes induced in apo-s100a1 protein by the disulphide formation between its CYS85 residue and b-mercaptoethanol
Class: metal binding protein
Keywords: s100 protein, s100a1, mixed disulfides, b-mercaptoethanol, metal binding protein
Deposited on
2007-05-23, released
2008-02-19
The last revision prior to the SCOPe 2.06 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protein S100-A1
Species: Bos taurus [TaxId:9913]
Gene: S100a1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d2jpta_ - Chain 'B':
Compound: Protein S100-A1
Species: Bos taurus [TaxId:9913]
Gene: S100a1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d2jptb_ - Heterogens: BME
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2jptA (A:)
gseletametlinvfhahsgkegdkyklskkelkellqtelsgfldaqkdadavdkvmke
ldedgdgevdfqeyvvlvaaltvacnnffwens
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2jptB (B:)
gseletametlinvfhahsgkegdkyklskkelkellqtelsgfldaqkdadavdkvmke
ldedgdgevdfqeyvvlvaaltvacnnffwens