PDB entry 2jpt

View 2jpt on RCSB PDB site
Description: Structural changes induced in apo-s100a1 protein by the disulphide formation between its CYS85 residue and b-mercaptoethanol
Class: metal binding protein
Keywords: s100 protein, s100a1, mixed disulfides, b-mercaptoethanol, metal binding protein
Deposited on 2007-05-23, released 2008-02-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-A1
    Species: Bos taurus [TaxId:9913]
    Gene: S100a1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02639 (0-92)
      • engineered (63)
    Domains in SCOPe 2.07: d2jpta_
  • Chain 'B':
    Compound: Protein S100-A1
    Species: Bos taurus [TaxId:9913]
    Gene: S100a1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02639 (0-92)
      • engineered (63)
    Domains in SCOPe 2.07: d2jptb_
  • Heterogens: BME

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jptA (A:)
    gseletametlinvfhahsgkegdkyklskkelkellqtelsgfldaqkdadavdkvmke
    ldedgdgevdfqeyvvlvaaltvacnnffwens
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jptB (B:)
    gseletametlinvfhahsgkegdkyklskkelkellqtelsgfldaqkdadavdkvmke
    ldedgdgevdfqeyvvlvaaltvacnnffwens