PDB entry 2jpq

View 2jpq on RCSB PDB site
Description: Solution NMR structure of homodimer VP2129 from Vibrio parahaemolyticus. Northeast Structural Genomics Consortium target VpR61.
Class: structural genomics
Keywords: dimer, all alpha, homodimer, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG
Deposited on 2007-05-21, released 2007-06-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UPF0352 protein VP2129
    Species: Vibrio parahaemolyticus [TaxId:670]
    Gene: VP2129
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q87MV2 (0-74)
      • cloning artifact (75-76)
      • expression tag (77-82)
    Domains in SCOPe 2.06: d2jpqa1, d2jpqa2
  • Chain 'B':
    Compound: UPF0352 protein VP2129
    Species: Vibrio parahaemolyticus [TaxId:670]
    Gene: VP2129
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q87MV2 (0-74)
      • cloning artifact (75-76)
      • expression tag (77-82)
    Domains in SCOPe 2.06: d2jpqb2, d2jpqb3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2jpqA (A:)
mpitskytdeqvekilaevalvlekhaaspeltlmiagniatnvlnqrvaasqrkliaek
faqalmssletpkthlehhhhhh

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2jpqB (B:)
mpitskytdeqvekilaevalvlekhaaspeltlmiagniatnvlnqrvaasqrkliaek
faqalmssletpkthlehhhhhh