PDB entry 2jpo

View 2jpo on RCSB PDB site
Description: NMR structure of Antheraea polyphemus pheromone-binding protein 1 at pH 4.5
Class: transport protein
Keywords: insect odorant-binding protein, pH-dependent conformation, helix insertion, TRANSPORT PROTEIN
Deposited on 2007-05-20, released 2007-10-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-10-12, with a file datestamp of 2011-10-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pheromone-binding protein
    Species: Antheraea polyphemus [TaxId:7120]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2jpoa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jpoA (A:)
    speimknlsnnfgkamdqckdelslpdsvvadlynfwkddyvmtdrlagcainclatkld
    vvdpdgnlhhgnakdfamkhgadetmaqqlvdiihgceksappnddkcmktidvamcfkk
    eihklnwvpnmdlvigevlaev