PDB entry 2jpc

View 2jpc on RCSB PDB site
Description: SSRB DNA Binding Protein
Class: DNA binding protein
Keywords: DNA Binding Protein, Structural Genomics, PSI-2, Protein Structure Initiative, Integrated Center for Structure and Function Innovation, ISFI
Deposited on 2007-05-03, released 2007-07-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SsrB
    Species: Salmonella typhimurium [TaxId:602]
    Gene: ssrB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2jpca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jpcA (A:)
    lrerqvlklidegytnhgiseklhisiktvethrmnmmrklqvhkvtellncarrmrlie
    y