PDB entry 2jou

View 2jou on RCSB PDB site
Description: NMR structure of Mini-B, an N-terminal- C-terminal construct from human Surfactant Protein-B (SP-B), in Hexafluoroisopropanol (HFIP)
Class: surface active protein
Keywords: Mini-B, SP-B, Surfactant Protein B, lipid associated protein, SURFACE ACTIVE PROTEIN
Deposited on 2007-03-26, released 2007-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pulmonary surfactant-associated protein B
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2joua1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jouA (A:)
    cwlcralikriqamipkggrmlpqlvcrlvlrcs