PDB entry 2jot

View 2jot on RCSB PDB site
Description: Nuclear Magnetic Resonance Studies on Huwentoxin-XI from the Chinese Bird Spider Ornithoctonus huwena
Class: toxin
Keywords: Proteinase inhibitor, TOXIN
Deposited on 2007-03-25, released 2007-04-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Huwentoxin-11
  Species: Ornithoctonus huwena [TaxId:29017]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P68425 (0-54)
  Domains in SCOPe 2.08: d2jota_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2jotA (A:)
  idtcrlpsdrgrckasferwyfngrtcakfiyggcggngnkfptqeacmkrcaka