PDB entry 2joj

View 2joj on RCSB PDB site
Description: NMR solution structure of N-terminal domain of Euplotes octocarinatus centrin
Class: cell cycle
Keywords: N-terminal domain; centrin solution structure; EF-Hand Calcium Binding Protein, CELL CYCLE
Deposited on 2007-03-14, released 2008-03-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Centrin protein
    Species: Euplotes octocarinatus [TaxId:5937]
    Gene: centrin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2joja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jojA (A:)
    lseeqkqeikeafdlfdtnktgsidyhelkvamralgfdvkkpeilelmneydregngyi
    gfddfldimtekiknrd