PDB entry 2jod

View 2jod on RCSB PDB site
Description: Pac1-Rshort N-terminal EC domain Pacap(6-38) complex
Class: signaling protein
Keywords: protein-peptide complex, SIGNALING PROTEIN
Deposited on 2007-03-07, released 2007-05-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-05, with a file datestamp of 2020-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Pituitary adenylate cyclase-activating polypeptide type I receptor
  Species: Homo sapiens [TaxId:9606]
  Gene: ADCYAP1R1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P41586 (5-105)
    • cloning artifact (0-4)
    • engineered (8)
  Domains in SCOPe 2.08: d2joda1, d2joda2
• Chain 'B':
  Compound: Pituitary adenylate cyclase-activating polypeptide
  Species: Homo sapiens [TaxId:9606]
  Gene: ADCYAP1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P18509 (0-32)
  Domains in SCOPe 2.08: d2jodb1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2jodA (A:)
  mgsmahsdgifkkeqamclekiqranelmgfndsspgcpgmwdnitcwkpahvgemvlvs
  cpelfrifnpdqdmgvvsrnctedgwsepfphyfdacgfdeyeset
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2jodB (B:)
  ftdsysryrkqmavkkylaavlgkrykqrvknk