PDB entry 2jo6

View 2jo6 on RCSB PDB site
Description: NMR structure of the E.coli protein NirD, Northeast Structural Genomics target ET100
Class: oxidoreductase
Keywords: all beta, ISP domain, Rieske iron-sulfur protein, 3-layer sandwich, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, OXIDOREDUCTASE
Deposited on 2007-02-21, released 2007-03-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-05, with a file datestamp of 2020-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitrite reductase [NAD(P)H] small subunit
    Species: Escherichia coli [TaxId:562]
    Gene: nirD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9I8 (3-110)
      • cloning artifact (111-112)
    Domains in SCOPe 2.08: d2jo6a1, d2jo6a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jo6A (A:)
    qghmsqwkdickiddilpetgvcallgdeqvaifrpyhsdqvfaisnidpffessvlsrg
    liaehqgelwvasplkkqrfrlsdglcmedeqfsvkhyearvkdgvvqlrggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jo6A (A:)
    msqwkdickiddilpetgvcallgdeqvaifrpyhsdqvfaisnidpffessvlsrglia
    ehqgelwvasplkkqrfrlsdglcmedeqfsvkhyearvkdgvvqlrggs