PDB entry 2jo0

View 2jo0 on RCSB PDB site
Description: The solution structure of the monomeric species of the C terminal domain of the CA protein of HIV-1
Class: viral protein
Keywords: hiv, monomer, capsid protein, viral protein
Deposited on 2007-02-17, released 2007-07-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Gag-Pol polyprotein
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35963 (1-86)
    • expression tag (0)
    • engineered (39)
  Domains in SCOPe 2.08: d2jo0a1, d2jo0a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2jo0A (A:)
  msptsildirqgpkepfrdyvdrfyktlraeqasqevknamtetllvqnanpdcktilka
  lgpaatleemmtacqgvggpghkarvl