PDB entry 2jnx

View 2jnx on RCSB PDB site
Description: NMR derived solution structure of an EF-hand Calcium Binding Protein from Entamoeba Histolytica
Class: metal binding protein
Keywords: Calcium Binding Protein, EhCaBP2, METAL BINDING PROTEIN
Deposited on 2007-02-11, released 2008-02-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calcium binding protein 2
    Species: Entamoeba histolytica [TaxId:5759]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jnxa_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jnxA (A:)
    maealfkqldangdgsvsyeevkafvsskrpikneqllqlifkaididgngeidlaeftk
    faaavkeqdlsdekvglkilyklmdadgdgkltkeevttffkkfgyekvvdqimkadang
    dgyitleeflafnl