PDB entry 2jnw

View 2jnw on RCSB PDB site
Description: Solution structure of a ERCC1-XPA heterodimer
Class: DNA binding protein
Keywords: ercc1, xpa, NER, recruitment, DNA BINDING PROTEIN
Deposited on 2007-02-07, released 2007-10-30
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA excision repair protein ERCC-1
    Species: Homo sapiens [TaxId:9606]
    Gene: ERCC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2jnwa1
  • Chain 'B':
    Compound: DNA-repair protein complementing XP-A cells
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jnwA (A:)
    mgsshhhhhhsqdpaksnsiivsprqrgnpvlkfvrnvpwefgdvipdyvlgqstcalfl
    slryhnlhpdyihgrlqslgknfalrvllvqvdvkdpqqalkelakmciladctlilaws
    peeagryletyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jnwA (A:)
    nsiivsprqrgnpvlkfvrnvpwefgdvipdyvlgqstcalflslryhnlhpdyihgrlq
    slgknfalrvllvqvdvkdpqqalkelakmciladctlilawspeeagryletyka
    

  • Chain 'B':
    No sequence available.