PDB entry 2jnv

View 2jnv on RCSB PDB site
Description: Solution structure of C-terminal domain of NifU-like protein from Oryza sativa
Class: metal transport
Keywords: iron-sulfur cluster binding, program for rice genome reserch, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL TRANSPORT
Deposited on 2007-02-06, released 2007-12-18
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NifU-like protein 1, chloroplast
    Species: Oryza sativa [TaxId:4530]
    Gene: NIFU1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84LK7 (2-82)
      • expression tag (0-1)
    Domains in SCOPe 2.05: d2jnva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jnvA (A:)
    mglpltagnvesvldqvrpyltadggdvalheiagnvvrlklqgacgscpsslitikrgi
    errlmekipdvaavepvtdketglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jnvA (A:)
    mglpltagnvesvldqvrpyltadggdvalheiagnvvrlklqgacgscpsslitikrgi
    errlmekipdvaavepvtdketg