PDB entry 2jnv
View 2jnv on RCSB PDB site
Description: Solution structure of C-terminal domain of NifU-like protein from Oryza sativa
Class: metal transport
Keywords: iron-sulfur cluster binding, program for rice genome reserch, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL TRANSPORT
Deposited on
2007-02-06, released
2007-12-18
The last revision prior to the SCOPe 2.05 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: NifU-like protein 1, chloroplast
Species: Oryza sativa [TaxId:4530]
Gene: NIFU1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d2jnva_
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2jnvA (A:)
mglpltagnvesvldqvrpyltadggdvalheiagnvvrlklqgacgscpsslitikrgi
errlmekipdvaavepvtdketglehhhhhh
Sequence, based on observed residues (ATOM records): (download)
>2jnvA (A:)
mglpltagnvesvldqvrpyltadggdvalheiagnvvrlklqgacgscpsslitikrgi
errlmekipdvaavepvtdketg