PDB entry 2jnp

View 2jnp on RCSB PDB site
Description: Solution structure of matrix metalloproteinase 3 (MMP-3) in the presence of N-isobutyl-N-[4-methoxyphenylsulfonyl]glycyl hydroxamic acid (NNGH)
Class: hydrolase
Keywords: metalloproteinase, MMP, HYDROLASE
Deposited on 2007-01-30, released 2007-12-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-05, with a file datestamp of 2020-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Matrix metalloproteinase-3
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP3, STMY1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2jnpa_
  • Heterogens: ZN, CA, NGH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jnpA (A:)
    gipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadimisfa
    vrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaaheighsl
    glfhsantealmyplyhsltdltrfrlsqddingiqslygp