PDB entry 2jnj

View 2jnj on RCSB PDB site
Description: Solution structure of the p8 TFIIH subunit
Class: transcription
Keywords: protein, TRANSCRIPTION
Deposited on 2007-01-26, released 2007-04-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TFIIH basal transcription factor complex TTD-A subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: GTF2H5, TTDA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6ZYL4 (3-73)
      • cloning artifact (0-2)
    Domains in SCOPe 2.08: d2jnja1, d2jnja2
  • Chain 'B':
    Compound: TFIIH basal transcription factor complex TTD-A subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: GTF2H5, TTDA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6ZYL4 (3-73)
      • cloning artifact (0-2)
    Domains in SCOPe 2.08: d2jnjb1, d2jnjb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2jnjA (A:)
gshmvnvlkgvliecdpamkqfllyldesnalgkkfiiqdiddthvfviaelvnvlqerv
gelmdqnafsltqk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2jnjB (B:)
gshmvnvlkgvliecdpamkqfllyldesnalgkkfiiqdiddthvfviaelvnvlqerv
gelmdqnafsltqk