PDB entry 2jng

View 2jng on RCSB PDB site
Description: Solution structure of the CUL7-CPH domain from Homo Sapiens; Northeast Structural Genomics Consortium target HT1.
Class: gene regulation
Keywords: p53 binding domain, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, GENE REGULATION
Deposited on 2007-01-23, released 2007-02-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cullin-7
  Species: Homo sapiens [TaxId:9606]
  Gene: CUL7, KIAA0076
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q14999 (4-End)
    • cloning artifact (3)
  Domains in SCOPe 2.08: d2jnga1, d2jnga2

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2jngA (A:)
  gshmrsefasgntyalyvrdtlqpgmrvrmlddyeeisagdegefrqsnngvppvqvfwe
  stgrtywvhwhmleilgfeediedmveadeyqgavasrvlgralp
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2jngA (A:)
  mrsefasgntyalyvrdtlqpgmrvrmlddyeeisagdegefrqsnngvppvqvfwestg
  rtywvhwhmleilgfee