PDB entry 2jne

View 2jne on RCSB PDB site
Description: NMR structure of E.coli YfgJ modelled with two Zn+2 bound. Northeast Structural Genomics Consortium Target ER317.
Class: metal binding protein
Keywords: C4, C3H, C7H, zinc fingers, two zinc, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, METAL BINDING PROTEIN
Deposited on 2007-01-12, released 2007-02-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein yfgJ
    Species: Escherichia coli [TaxId:562]
    Gene: yfgJ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2jnea1
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jneA (A:)
    fcltlrrrytmgsshhhhhhssglvprgshmelhcpqcqhvldqdngharcrscgefiem
    kalcpdchqplqvlkacgavdyfcqhghgliskkrvefvla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jneA (A:)
    melhcpqcqhvldqdngharcrscgefiemkalcpdchqplqvlkacgavdyfcqhghgl
    iskkrvefvla