PDB entry 2jn8

View 2jn8 on RCSB PDB site
Description: Solution NMR structure of Q8ZRJ2 from Salmonella typhimurium. Northeast Structural Genomics target StR65.
Class: structural genomics, unknown function
Keywords: NMR structure, NESG, PSI-2, AutoStructure, Structural Genomics, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2006-12-29, released 2007-01-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative cytoplasmic protein
    Species: Salmonella typhimurium [TaxId:602]
    Gene: STM0327
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZRJ2 (Start-106)
      • cloning artifact (107-108)
      • expression tag (109)
    Domains in SCOPe 2.08: d2jn8a1, d2jn8a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jn8A (A:)
    mvnfkdksmptaiekaldfiggmntsasvphsmdestakgilkylhdlgvpvspevvvar
    geqegwnpeftkkvagwaekvasgnriliknpeyfstymqeqlkelvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jn8A (A:)
    vnfkdksmptaiekaldfiggmntsasvphsmdestakgilkylhdlgvpvspevvvarg
    eqegwnpeftkkvagwaekvasgnriliknpeyfstymqeqlkelvleh