PDB entry 2jn6

View 2jn6 on RCSB PDB site
Description: Solution NMR structure of Protein Cgl2762 from Corynebacterium Glutamicum: Northeast Structural Genomics Consortium Target CgR3
Class: structural genomics, unknown function
Keywords: GFT NMR, PSI-2, Protein structure, Structural Genomics, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2006-12-28, released 2007-02-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-05, with a file datestamp of 2020-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein Cgl2762
    Species: Corynebacterium glutamicum [TaxId:1718]
    Gene: tnp8a ISCg8a
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NM20 (0-88)
      • cloning artifact (89-90)
      • expression tag (91-96)
    Domains in SCOPe 2.08: d2jn6a1, d2jn6a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2jn6A (A:)
mptktyseefkrdavalyensdgaslqqiandlginrvtlknwiikygsnhnvqgttpsa
avseaeqirqlkkenalqrartrhpaesclehhhhhh