PDB entry 2jn0

View 2jn0 on RCSB PDB site
Description: Solution NMR structure of the ygdR protein from Escherichia coli. Northeast Structural Genomics target ER382A.
Class: membrane protein
Keywords: solution NMR structure, Hypothetical Lipoprotein, PSI-2 target, Structural Genomics, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, MEMBRANE PROTEIN
Deposited on 2006-12-15, released 2007-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical lipoprotein ygdR
    Species: Escherichia coli [TaxId:562]
    Gene: ygdR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jn0a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2jn0A (A:)
mssdyvmatkdgrmiltdgkpeidddtglvsyhdqqgnamqinrddvsqiierlehhhhh
h

    Sequence, based on observed residues (ATOM records): (download) 
    >2jn0A (A:)
dyvmatkdgrmiltdgkpeidddtglvsyhdqqgnamqinrddvsqiier