PDB entry 2jmu

View 2jmu on RCSB PDB site
Description: NMR structure of the mouse thiamine triphosphatase
Class: hydrolase
Keywords: thiamine triphosphatase, Structural Genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, CESG, HYDROLASE
Deposited on 2006-12-05, released 2006-12-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thiamine-triphosphatase
    Species: Mus musculus [TaxId:10090]
    Gene: Thtpa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8JZL3 (1-223)
      • cloning artifact (0)
    Domains in SCOPe 2.06: d2jmua1, d2jmua2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jmuA (A:)
    saqglieverkfapgpdteerlqelgatlehrvtfrdtyydtselslmlsdhwlrqregs
    gwelkcpgvtgvsgphneyvevtseaaivaqlfellgsgeqkpagvaavlgslklqevas
    fittrsswklalsgahgqepqltidldsadfgyavgeveamvhekaevpaalekiitvss
    mlgvpaqeeapaklmvylqrfrpldyqrlleaassgeatgdsas