PDB entry 2jmq

View 2jmq on RCSB PDB site
Description: Plant Homeodomain Finger of the tumour suppressor ING4
Class: gene regulation
Keywords: PHD, Zn
Deposited on 2006-11-28, released 2006-12-12
The last revision prior to the SCOP 1.73 freeze date was dated 2007-05-08, with a file datestamp of 2007-06-04.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Inhibitor of growth protein 4
  Species: HOMO SAPIENS
  Gene: ING4
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9UNL4 (0-61)
  Domains in SCOP 1.73: d2jmqa1
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2jmqA (A:)
  dmpvdpneptyclchqvsygemigcdnpdcsiewfhfacvglttkprgkwfcprcsqerk
  kk