PDB entry 2jmm

View 2jmm on RCSB PDB site
Description: NMR solution structure of a minimal transmembrane beta-barrel platform protein
Class: membrane protein
Keywords: membrane protein
Deposited on 2006-11-20, released 2007-07-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-05, with a file datestamp of 2020-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: outer membrane protein a
    Species: Escherichia coli [TaxId:562]
    Gene: ompA, con, tolG, tut
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2jmma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2jmmA (A:)
mpkdntwytgaklgwsqysrenqlgagafggyqvnpyvgfemgydwlgrmprkaqgvqlt
aklgypklgtddldiytrlggmvwradtsdkdgngyisaaeasvspvfaggveyvirrri
tpeiatrleyqwtnnasdngmlslgvsyrfgqgeaa