PDB entry 2jmi

View 2jmi on RCSB PDB site
Description: NMR solution structure of PHD finger fragment of Yeast Yng1 protein in free state
Class: protein binding
Keywords: PHD, NMR, Histone, Recognition, Yeast, PROTEIN BINDING
Deposited on 2006-11-15, released 2007-07-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein YNG1
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: YNG1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q08465
  Domains in SCOPe 2.08: d2jmia_
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2jmiA (A:)
  gplgshmasefinqgdvtegnnnqeevycfcrnvsygpmvacdnpacpfewfhygcvglk
  qapkgkwycskdckeianqrskskrqkrrk
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2jmiA (A:)
  qeevycfcrnvsygpmvacdnpacpfewfhygcvglkqapkgkwycskdckeianqrsks