PDB entry 2jmg

View 2jmg on RCSB PDB site
Description: Solution structure of V7R mutant of HIV-1 myristoylated matrix protein
Class: viral protein
Keywords: V7R mutant of HIV-1 myristoylated matrix protein, VIRAL PROTEIN
Deposited on 2006-11-11, released 2007-02-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gag polyprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72497 (0-130)
      • engineered (5)
    Domains in SCOPe 2.08: d2jmga_
  • Heterogens: MYR

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jmgA (A:)
    garasrlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqil
    gqlqpslqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaaad
    tgnnsqvsqny