PDB entry 2jmf

View 2jmf on RCSB PDB site
Description: Solution structure of the Su(dx) WW4- Notch PY peptide complex
Class: Ligase/Signaling Protein
Keywords: WW domain, Notch, NMR solution, complex, Ligase/Signaling Protein COMPLEX
Deposited on 2006-11-05, released 2007-08-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase suppressor of deltex
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Su dx
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2jmfa_
  • Chain 'B':
    Compound: Neurogenic locus Notch protein
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: N
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jmfA (A:)
    gplgspefhmvslinegplppgweirytaagerffvdhntrrttfedprpgap
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jmfA (A:)
    vslinegplppgweirytaagerffvdhntrrttfedprpgap
    

  • Chain 'B':
    No sequence available.