PDB entry 2jmc

View 2jmc on RCSB PDB site
Description: Chimer between Spc-SH3 and P41
Class: signaling protein
Keywords: chimer, Spc-SH3, P41, SIGNALING PROTEIN
Deposited on 2006-11-02, released 2007-04-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Spectrin alpha chain, brain and P41 peptide chimera
    Species: Gallus gallus [TaxId:9031]
    Gene: SPTAN1, SPTA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07751 (4-46)
      • cloning artifact (0-3)
      • linker (47-48)
      • see remark 999 (63)
      • linker (64-66)
      • see remark 999 (67-76)
    • Uniprot P07751 (49-62)
    Domains in SCOPe 2.08: d2jmca1, d2jmca2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jmcA (A:)
    gamgprevtmkkgdiltllnstnkdwwkvevndrqgfvpaayvkkldsgtgkelvlalyd
    yqesgdnapsysppppp