PDB entry 2jm5

View 2jm5 on RCSB PDB site
Description: Solution Structure of the RGS domain from human RGS18
Class: signaling protein
Keywords: signaling protein, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2006-10-11, released 2006-10-24
The last revision prior to the SCOP 1.73 freeze date was dated 2006-10-24, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulator of G-protein signaling 18
    Species: HOMO SAPIENS
    Gene: RGS18, RGS13
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NS28 (2-End)
      • cloning artifact (0-1)
    Domains in SCOP 1.73: d2jm5a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2jm5A (A:)
smvspeeavkwgesfdkllshrdgleaftrflktefseeniefwiacedfkkskgpqqih
lkakaiyekfiqtdapkevnldfhtkevitnsitqptlhsfdaaqsrvyqlmeqdsytrf
lksdiyldlmegrpqrptnlrrrsrsftcne

    Sequence, based on observed residues (ATOM records): (download) 
    >2jm5A (A:)
smvspeeavkwgesfdkllshrdgleaftrflktefseeniefwiacedfkkskgpqqih
lkakaiyekfiqtdapkevnldfhtkevitnsitqptlhsfdaaqsrvyqlmeqdsytrf
lksdiyldlmegrp