PDB entry 2jkx

View 2jkx on RCSB PDB site
Description: galactose oxidase. matgo. copper free, expressed in pichia pastoris.
Class: oxidoreductase
Keywords: metal-binding, thioether bond, oxidoreductase, copper, secreted, oxidases, kelch repeat, copper enzymes, enzyme catalysis, protein engineering
Deposited on 2008-09-01, released 2008-09-09
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.167
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galactose oxidase
    Species: GIBBERELLA ZEAE [TaxId:5518]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2jkxa1, d2jkxa2, d2jkxa3
  • Heterogens: ACT, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jkxA (A:)
    asapigsaisrnnwavtcdsaqsgnecnkaidgnkdtfwhtfygangdpkpphtytidmk
    ttqnvnglsmlprqdgnqngwigrhevylssdgtnwgspvasgswfadsttkysnfetrp
    aryvrlvaiteangqpwtsiaeinvfqassytapqpglgrwgptidlpivpaaaaiepts
    grvlmwssyrndafggspggitltsswdpstgivsdrtvtvtkhdmfcpgismdgngqiv
    vtggndakktslydsssdswipgpdmqvargyqssatmsdgrvftiggswsggvfeknge
    vyspssktwtslpnakvnpmltadkqglyrsdnhawlfgwkkgsvfqagpstamnwyyts
    gsgdvksagkrqsnrgvapdamcgnavmydavkgkiltfggspdyqdsdattnahiitlg
    epgtspntvfasnglyfartfhtsvvlpdgstfitggqrrgipfedstpvftpeiyvpeq
    dtfykqnpnsivrvyhsislllpdgrvfngggglcgdcttnhfdaqiftpnylynsngnl
    atrpkitrtstqsvkvggritistdssiskaslirygtathtvntdqrripltltnnggn
    sysfqvpsdsgvalpgywmlfvmnsagvpsvastirvtq