PDB entry 2jkq

View 2jkq on RCSB PDB site
Description: focal adhesion kinase catalytic domain in complex with bis-anilino pyrimidine inhibitor
Class: transferase
Keywords: transferase, nucleotide-binding, tyrosine-protein kinase, kinase inhibitor, integrin signaling, kinase, ATP-binding, cell migration, focal adhesion
Deposited on 2008-08-29, released 2008-09-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.217
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Focal adhesion kinase 1
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00944 (Start-275)
      • conflict (38)
      • conflict (105)
      • conflict (145-146)
    Domains in SCOPe 2.06: d2jkqa_
  • Heterogens: VG8, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jkqA (A:)
    strdyeiqrerielgrcigegqfgdvhqgiymspenpalavaiktcknctsdsvrekflq
    ealtmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayql
    stalayleskrfvhrdiaarnvlvssndcvklgdfglsrymedstyykaskgklpikwma
    pesinfrrftsasdvwmfgvcmweilmhgvkpfqgvknndvigriengerlpmppncppt
    lyslmtkcwaydpsrrprftelkaqlstileeeklq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jkqA (A:)
    dyeiqrerielgrcigegqfgdvhqgiymspenpalavaiktcknctsdsvrekflqeal
    tmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayqlsta
    layleskrfvhrdiaarnvlvssndcvklgdfglslpikwmapesinfrrftsasdvwmf
    gvcmweilmhgvkpfqgvknndvigriengerlpmppncpptlyslmtkcwaydpsrrpr
    ftelkaqlstileeeklq