PDB entry 2jkm

View 2jkm on RCSB PDB site
Description: focal adhesion kinase catalytic domain in complex with bis-anilino pyrimidine inhibitor
Class: transferase
Keywords: tyrosine-protein kinase, tyrosine- protein kinase, kinase, membrane, transferase, ATP-binding, integrin signaling, nucleotide-binding, focal adhesion, cell migration, kinase inhibitor, cell junction, cell membrane, phosphoprotein
Deposited on 2008-08-28, released 2008-09-09
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.21055
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Focal adhesion kinase 1
    Species: Gallus gallus [TaxId:9031]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00944 (Start-275)
      • conflict (105)
      • conflict (145-146)
    Domains in SCOPe 2.04: d2jkma_
  • Heterogens: BII, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jkmA (A:)
    strdyeiqrerielgrcigegqfgdvhqgiymspenpamavaiktcknctsdsvrekflq
    ealtmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayql
    stalayleskrfvhrdiaarnvlvssndcvklgdfglsrymedstyykaskgklpikwma
    pesinfrrftsasdvwmfgvcmweilmhgvkpfqgvknndvigriengerlpmppncppt
    lyslmtkcwaydpsrrprftelkaqlstileeeklq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jkmA (A:)
    rdyeiqrerielgrcigegqfgdvhqgiymspenpamavaiktcknctsdsvrekflqea
    ltmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayqlst
    alayleskrfvhrdiaarnvlvssndcvklgdfglsrlpikwmapesinfrrftsasdvw
    mfgvcmweilmhgvkpfqgvknndvigriengerlpmppncpptlyslmtkcwaydpsrr
    prftelkaqlstileeeklq