PDB entry 2jkj

View 2jkj on RCSB PDB site
Description: DraE Adhesin in complex with Chloramphenicol Succinate
Class: cell adhesion
Keywords: cell adhesion, upec, drae, daec, adhesin, fimbrium, haemagglutinin, cell projection, fimbrial adhesin, chloramphenicol succinate
Deposited on 2008-08-28, released 2008-12-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dr hemagglutinin structural subunit
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JKJ (Start-10)
      • conflict (27)
    • Uniprot P24093 (11-End)
    Domains in SCOPe 2.07: d2jkja1, d2jkja2
  • Chain 'B':
    Compound: dr hemagglutinin structural subunit
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JKJ (Start-10)
      • conflict (27)
    • Uniprot P24093 (11-End)
    Domains in SCOPe 2.07: d2jkjb1, d2jkjb2
  • Chain 'C':
    Compound: dr hemagglutinin structural subunit
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JKJ (Start-10)
      • conflict (27)
    • Uniprot P24093 (11-End)
    Domains in SCOPe 2.07: d2jkjc1, d2jkjc2
  • Chain 'D':
    Compound: dr hemagglutinin structural subunit
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JKJ (Start-10)
      • conflict (27)
    • Uniprot P24093 (11-End)
    Domains in SCOPe 2.07: d2jkjd1, d2jkjd2
  • Chain 'E':
    Compound: dr hemagglutinin structural subunit
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JKJ (Start-10)
      • conflict (27)
    • Uniprot P24093 (11-End)
    Domains in SCOPe 2.07: d2jkje1, d2jkje2
  • Chain 'F':
    Compound: dr hemagglutinin structural subunit
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JKJ (Start-10)
      • conflict (27)
    • Uniprot P24093 (11-148)
    Domains in SCOPe 2.07: d2jkjf1, d2jkjf2
  • Heterogens: SO4, CLM, TH8, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jkjA (A:)
    rgshhhhhhgsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalg
    cdarqvalkadtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswgg
    iigiyvdgqqtntppgnytltltggywak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jkjA (A:)
    gsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgcdarqvalk
    adtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswggiigiyvdgq
    qtntppgnytltltggywa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jkjB (B:)
    rgshhhhhhgsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalg
    cdarqvalkadtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswgg
    iigiyvdgqqtntppgnytltltggywak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jkjB (B:)
    gsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgcdarqvalk
    adtdnfeqgkfflisdnnrdklyvnirptdsawttdngvfykndvgswggiigiyvdgqq
    tntppgnytltltggywa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2jkjC (C:)
    rgshhhhhhgsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalg
    cdarqvalkadtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswgg
    iigiyvdgqqtntppgnytltltggywak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jkjC (C:)
    gsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgcdarqvalk
    adtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswggiigiyvdgq
    qtntppgnytltltggywa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2jkjD (D:)
    rgshhhhhhgsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalg
    cdarqvalkadtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswgg
    iigiyvdgqqtntppgnytltltggywak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jkjD (D:)
    gsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgcdarqvalk
    adtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswggiigiyvdgq
    qtntppgnytltltggywa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2jkjE (E:)
    rgshhhhhhgsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalg
    cdarqvalkadtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswgg
    iigiyvdgqqtntppgnytltltggywak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jkjE (E:)
    gsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgcdarqvalk
    adtdnfefflisdnnrdklyvnirptdnsawttdngvfykndvgswggiigiyvdgqqtn
    tppgnytltltggywa
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2jkjF (F:)
    rgshhhhhhgsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalg
    cdarqvalkadtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswgg
    iigiyvdgqqtntppgnytltltggywak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jkjF (F:)
    gsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgcdarqvalk
    adtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswggiigiyvdgq
    qtntppgnytltltggywak