PDB entry 2jk7

View 2jk7 on RCSB PDB site
Description: xiap bir3 bound to a smac mimetic
Class: apoptosis
Keywords: zinc-finger, polymorphism, smac mimetic, metal-binding, bir3, zinc, ligase, apoptosis, cytoplasm, x-linked inhibitor of apoptosis, ubl conjugation pathway, thiol protease inhibitor, phosphoprotein, ubl conjugation, protease inhibitor
Deposited on 2008-08-21, released 2008-11-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 2.82 Å
R-factor: 0.229
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: baculoviral iap repeat-containing protein 4
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P98170
  Domains in SCOPe 2.08: d2jk7a_
• Heterogens: BI6, ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2jk7A (A:)
  sdavssdrnfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkc
  fhcgggltdwkpsedpweqhakwypgckylleqkgqeyinnihlthsleeclvrtt
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2jk7A (A:)
  fpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltd
  wkpsedpweqhakwypgckylleqkgqeyinnihlth