PDB entry 2jk3

View 2jk3 on RCSB PDB site
Description: crystal structure of the hlyiir mutant protein with residues 169-186 substituted by gssgssg linker
Class: transcription
Keywords: DNA-binding protein, transcription regulation, DNA-binding, tetr family, transcription, transcriptional regulator
Deposited on 2008-08-11, released 2008-08-19
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-10-12, with a file datestamp of 2011-10-07.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.201
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemolysin II regulatory protein
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JK3 (166-172)
    • Uniprot Q7X506 (173-187)
    Domains in SCOPe 2.04: d2jk3a1, d2jk3a2
  • Chain 'B':
    Compound: hemolysin II regulatory protein
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JK3 (166-172)
    • Uniprot Q7X506 (173-187)
    Domains in SCOPe 2.04: d2jk3b1, d2jk3b2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jk3A (A:)
    asreqtmenilkaakkkfgergyegtsiqeiakeakvnvamasyyfngkenlyyevfkky
    glanelpnfleknqfnpinalreyltvftthikenpeigtlayeeiikesarlekikpyf
    igsfeqlkeilqegekqgvfhffsinhtihwitsivlfpkfkkfidgssgssglvsriis
    altdkpni
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jk3A (A:)
    sreqtmenilkaakkkfgergyegtsiqeiakeakvnvamasyyfngkenlyyevfkkyg
    lanelpnfleknqfnpinalreyltvftthikenpeigtlayeeiikesarlekikpyfi
    gsfeqlkeilqegekqgvfhffsinhtihwitsivlfpkfkkfidgglvsriisaltdkp
    ni
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jk3B (B:)
    asreqtmenilkaakkkfgergyegtsiqeiakeakvnvamasyyfngkenlyyevfkky
    glanelpnfleknqfnpinalreyltvftthikenpeigtlayeeiikesarlekikpyf
    igsfeqlkeilqegekqgvfhffsinhtihwitsivlfpkfkkfidgssgssglvsriis
    altdkpni
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jk3B (B:)
    sreqtmenilkaakkkfgergyegtsiqeiakeakvnvamasyyfngkenlyyevfkkyg
    llpnfleknqfnpinalreyltvftthikenpeigtlayeeiikesarlekikpyfigsf
    eqlkeilqegekqgvfhffsinhtihwitsivlfpkfkkfidgssglvsriisaltdkpn
    i