PDB entry 2jjy

View 2jjy on RCSB PDB site
Description: crystal structure of francisella tularensis enoyl reductase (ftfabi) with bound nad
Class: oxidoreductase
Keywords: oxidoreductase, fatty acid biosynthesis
Deposited on 2008-04-25, released 2009-02-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.206
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enoyl-[acyl-carrier-protein] reductase
    Species: FRANCISELLA TULARENSIS [TaxId:263]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14I55 (Start-259)
      • expression tag (260-267)
    Domains in SCOPe 2.07: d2jjya1, d2jjya2
  • Chain 'B':
    Compound: Enoyl-[acyl-carrier-protein] reductase
    Species: FRANCISELLA TULARENSIS [TaxId:263]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14I55 (Start-259)
      • expression tag (260-262)
    Domains in SCOPe 2.07: d2jjyb1, d2jjyb2
  • Chain 'C':
    Compound: Enoyl-[acyl-carrier-protein] reductase
    Species: FRANCISELLA TULARENSIS [TaxId:263]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14I55 (Start-259)
      • expression tag (260-267)
    Domains in SCOPe 2.07: d2jjyc1, d2jjyc2
  • Chain 'D':
    Compound: Enoyl-[acyl-carrier-protein] reductase
    Species: FRANCISELLA TULARENSIS [TaxId:263]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jjyd_
  • Heterogens: NAD

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jjyA (A:)
    mgflagkkilitgllsnksiaygiakamhregaelaftyvgqfkdrveklcaefnpaavl
    pcdvisdqeikdlfvelgkvwdgldaivhsiafaprdqlegnfidcvtregfsiahdisa
    ysfaalakegrsmmknrnasmvaltyigaekampsyntmgvakasleatvrytalalged
    gikvnavsagpiktlaasgisnfkkmldynamvsplkknvdimevgntvaflcsdmatgi
    tgevvhvdagyhcvsmgnvllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jjyA (A:)
    gflagkkilitgllsnksiaygiakamhregaelaftyvgqfkdrveklcaefnpaavlp
    cdvisdqeikdlfvelgkvwdgldaivhsiafaprdqlegnfidcvtregfsiahdisay
    sfaalakegrsmmknrnasmvaltyigaekampsyntmgvakasleatvrytalalgedg
    ikvnavsagpikkmldynamvsplkknvdimevgntvaflcsdmatgitgevvhvdagyh
    cvsmgnvllehhhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jjyB (B:)
    mgflagkkilitgllsnksiaygiakamhregaelaftyvgqfkdrveklcaefnpaavl
    pcdvisdqeikdlfvelgkvwdgldaivhsiafaprdqlegnfidcvtregfsiahdisa
    ysfaalakegrsmmknrnasmvaltyigaekampsyntmgvakasleatvrytalalged
    gikvnavsagpiktlaasgisnfkkmldynamvsplkknvdimevgntvaflcsdmatgi
    tgevvhvdagyhcvsmgnvllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jjyB (B:)
    gflagkkilitgllsnksiaygiakamhregaelaftyvgqfkdrveklcaefnpaavlp
    cdvisdqeikdlfvelgkvwdgldaivhsiafaprdqlegnfidcvtregfsiahdisay
    sfaalakegrsmmknrnasmvaltyigaekampsyntmgvakasleatvrytalalgedg
    ikvnavsagpiktlmvsplkknvdimevgntvaflcsdmatgitgevvhvdagyhcvsmg
    nvlleh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2jjyC (C:)
    mgflagkkilitgllsnksiaygiakamhregaelaftyvgqfkdrveklcaefnpaavl
    pcdvisdqeikdlfvelgkvwdgldaivhsiafaprdqlegnfidcvtregfsiahdisa
    ysfaalakegrsmmknrnasmvaltyigaekampsyntmgvakasleatvrytalalged
    gikvnavsagpiktlaasgisnfkkmldynamvsplkknvdimevgntvaflcsdmatgi
    tgevvhvdagyhcvsmgnvllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jjyC (C:)
    gflagkkilitgllsnksiaygiakamhregaelaftyvgqfkdrveklcaefnpaavlp
    cdvisdqeikdlfvelgkvwdgldaivhsiafaprdqlegnfidcvtregfsiahdisay
    sfaalakegrsmmknrnasmvaltyigaekampsyntmgvakasleatvrytalalgedg
    ikvnavsagpidynamvsplkknvdimevgntvaflcsdmatgitgevvhvdagyhcvsm
    gnvllehhhhhh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2jjyD (D:)
    mgflagkkilitgllsnksiaygiakamhregaelaftyvgqfkdrveklcaefnpaavl
    pcdvisdqeikdlfvelgkvwdgldaivhsiafaprdqlegnfidcvtregfsiahdisa
    ysfaalakegrsmmknrnasmvaltyigaekampsyntmgvakasleatvrytalalged
    gikvnavsagpiktlaasgisnfkkmldynamvsplkknvdimevgntvaflcsdmatgi
    tgevvhvdagyhcvsmgnvllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jjyD (D:)
    gflagkkilitgllsnksiaygiakamhregaelaftyvgqfkdrveklcaefnpaavlp
    cdvisdqeikdlfvelgkvwdgldaivhsiafaprdqlegnfidcvtregfsiahdisay
    sfaalakegrsmmknrnasmvaltyigaekampsyntmgvakasleatvrytalalgedg
    ikvnavsagpikmldynamvsplkknvdimevgntvaflcsdmatgitgevvhvdagyhc
    vsmgnvl