PDB entry 2jjv

View 2jjv on RCSB PDB site
Description: structure of human signal regulatory protein (sirp) beta(2)
Class: immune system
Keywords: immune system, immunoglobulin superfamily, signal regulatory protein beta, sirp, sirpb2, paired receptor
Deposited on 2008-04-22, released 2008-08-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.174
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: signal-regulatory protein beta 1.
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2jjva_
  • Chain 'B':
    Compound: signal-regulatory protein beta 1.
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2jjvb_
  • Heterogens: SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jjvA (A:)
    eeelqviqpdksisvaagesatlhctvtslipvgpiqwfrgagpgreliynqkeghfprv
    ttvsdltkrnnmdfsirisnitpadagtyycvkfrkgspdhvefksgagtelsvrakpst
    rhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jjvA (A:)
    elqviqpdksisvaagesatlhctvtslipvgpiqwfrgagpgreliynqhfprvttvsd
    ltkrnnmdfsirisnitpadagtyycvkfrkgspdhvefksgagtelsvr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jjvB (B:)
    eeelqviqpdksisvaagesatlhctvtslipvgpiqwfrgagpgreliynqkeghfprv
    ttvsdltkrnnmdfsirisnitpadagtyycvkfrkgspdhvefksgagtelsvrakpst
    rhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jjvB (B:)
    eelqviqpdksisvaagesatlhctvtslipvgpiqwfrgagpgreliynqkeghfprvt
    tvsdltkrnnmdfsirisnitpadagtyycvkfrkgspdhvefksgagtelsvra