PDB entry 2jju

View 2jju on RCSB PDB site
Description: structure of human signal regulatory protein (sirp) beta
Class: immune system
Keywords: immunoglobulin domain, immunoglobulin superfamily, signal regulatory protein beta, immune system, transmembrane, paired receptor, alternative splicing, sirp, sirpb1, membrane, polymorphism, glycoprotein
Deposited on 2008-04-22, released 2008-08-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.19 Å
R-factor: 0.14
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: signal regulatory protein beta-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2jjua_
  • Chain 'B':
    Compound: signal regulatory protein beta-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2jjub_
  • Heterogens: CL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jjuA (A:)
    edelqviqpeksvsvaagesatlrcamtslipvgpimwfrgagagreliynqkeghfprv
    ttvseltkrnnldfsisisnitpadagtyycvkfrkgspddvefksgagtelsvrakpst
    rhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jjuA (A:)
    elqviqpeksvsvaagesatlrcamtslipvgpimwfrgagagreliynqkeghfprvtt
    vnldfsisisnitpadagtyycvkfrkgspddvefksgagtelsvra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jjuB (B:)
    edelqviqpeksvsvaagesatlrcamtslipvgpimwfrgagagreliynqkeghfprv
    ttvseltkrnnldfsisisnitpadagtyycvkfrkgspddvefksgagtelsvrakpst
    rhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jjuB (B:)
    elqviqpeksvsvaagesatlrcamtslipvgpimwfrgagagreliynqkeghfprvtt
    vseltkrnnldfsisisnitpadagtyycvkfrkgddvefksgagtelsvra