PDB entry 2jjp

View 2jjp on RCSB PDB site
Description: Structure of cytochrome P450 EryK in complex with inhibitor ketoconazole (KC)
Class: oxidoreductase
Keywords: iron, heme, monooxygenase, metal-binding, antibiotic biosynthesis, tie-rod mechanism of action, oxidoreductase, substrate specificity
Deposited on 2008-04-15, released 2009-07-14
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-08-22, with a file datestamp of 2012-08-17.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.199
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450 113a1
    Species: SACCHAROPOLYSPORA ERYTHRAEA [TaxId:1836]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JJP
      • engineered mutation (14)
      • engineered mutation (343)
    • Uniprot P48635 (14-410)
    Domains in SCOPe 2.03: d2jjpa_
  • Heterogens: HEM, KLN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jjpA (A:)
    mfadvettccarrtlttidevpgmadetalldwlgtmrekqpvwqdrygvwhvfrhadvq
    tvlrdtatfssdptrviegasptpgmiheidppehralrkvvssaftprtisdleprird
    vtrslladagesfdlvdvlafplpvtivaellglppmdheqfgdwsgalvdiqmddptdp
    alaeriadvlnpltaylkarcaerradpgddlisrlvlaevdgralddeeaanfstalll
    aghitttvllgnivrtldehpahwdaaaedpgripaiveevlryrppfpqmqrtttkate
    vagvpipadvmvntwvlsanrdsdahddpdrfdpsrksggaaqlsfghgvhfclgaplar
    lenrvaleeiiarfgrltvdrdderlrhfeqivlgtrhlpvlagssprqsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jjpA (A:)
    lttidevpgmadetalldwlgtmrekqpvwqdrygvwhvfrhadvqtvlrdtatfssdpt
    rviegasptpgmiheidppehralrkvvssaftprtisdleprirdvtrslladagesfd
    lvdvlafplpvtivaellglppmdheqfgdwsgalvdiqmddptdpalaeriadvlnplt
    aylkarcaerradpgddlisrlvlaevdgralddeeaanfstalllaghitttvllgniv
    rtldehpahwdaaaedpgripaiveevlryrppfpqmqrtttkatevagvpipadvmvnt
    wvlsanrdsdahddpdrfdpsrksggaaqlsfghgvhfclgaplarlenrvaleeiiarf
    grltvdrdderlrhfeqivlgtrhlpvlagssprqsa