PDB entry 2jji

View 2jji on RCSB PDB site
Description: endothiapepsin in complex with a gem-diol inhibitor.
Class: hydrolase/hydrolase inhibitor
Keywords: acid proteinase, aspartyl protease, zymogen, hydrolase-hydrolase inhibitor complex
Deposited on 2008-04-09, released 2008-05-27
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-21.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: 0.156
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endothiapepsin
    Species: CRYPHONECTRIA PARASITICA [TaxId:5116]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2jjia_
  • Heterogens: 0QS, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jjiA (A:)
    stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
    psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
    tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
    gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
    gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
    ginifgdvalkaafvvfngattptlgfask