PDB entry 2jjb

View 2jjb on RCSB PDB site
Description: family 37 trehalase from escherichia coli in complex with casuarine-6-o-alpha-glucopyranose
Class: hydrolase
Keywords: hydrolase, glycosidase, glycoside hydrolase
Deposited on 2008-03-28, released 2009-01-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-04-20, with a file datestamp of 2011-04-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.179
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: periplasmic trehalase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2jjba_
  • Chain 'B':
    Compound: periplasmic trehalase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2jjbb_
  • Chain 'C':
    Compound: periplasmic trehalase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2jjbc_
  • Chain 'D':
    Compound: periplasmic trehalase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2jjbd_
  • Heterogens: 3CU, GLC, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jjbA (A:)
    eetpvtpqppdillgplfndvqnaklfpdqktfadavpnsdplmiladyrmqqnqsgfdl
    rhfvnvnftlpkegekyvppegqslrehidglwpvltrstentekwdsllplpepyvvpg
    grfrevyywdsyftmlglaesghwdkvadmvanfaheidtyghipngnrsyylsrsqppf
    falmvellaqhegdaalkqylpqmqkeyaywmdgvenlqagqqekrvvklqdgtllnryw
    ddrdtprpeswvediataksnpnrpateiyrdlrsaaasgwdfssrwmdnpqqlntlrtt
    sivpvdlnslmfkmekilaraskaagdnamanqyetlanarqkgiekylwndqqgwyady
    dlkshkvrnqltaaalfplyvnaaakdrankmatatkthllqpgglnttsvksgqqwdap
    ngwaplqwvateglqnygqkevamdiswhfltnvqhtydrekklvekydvsttgtggggg
    eyplqdgfgwtngvtlkmldlicpkeqpcdnvpatrptvksattqpstkeaqptp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jjbA (A:)
    vtpqppdillgplfndvqnaklfpdqktfadavpnsdplmiladyrmqqnqfdlrhfvnv
    nftlpkyvppegqslrehidglwpvltrstentekwdsllplpepyvvpggrfrevyywd
    syftmlglaesghwdkvadmvanfaheidtyghipngnrsyylsrsqppffalmvellaq
    hegdaalkqylpqmqkeyaywmdgvenlqagqqekrvvklqdgtllnrywddrdtprpes
    wvediataksnpnrpateiyrdlrsaaasgwdfssrwmdnpqqlntlrttsivpvdlnsl
    mfkmekilaraskaagdnamanqyetlanarqkgiekylwndqqgwyadydlkshkvrnq
    ltaaalfplyvnaaakdrankmatatkthllqpgglnttsvksgqqwdapngwaplqwva
    teglqnygqkevamdiswhfltnvqhtydrekklvekydvsttgtgggeyplqdgfgwtn
    gvtlkmldlicpkeqpcdnvpatr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jjbB (B:)
    eetpvtpqppdillgplfndvqnaklfpdqktfadavpnsdplmiladyrmqqnqsgfdl
    rhfvnvnftlpkegekyvppegqslrehidglwpvltrstentekwdsllplpepyvvpg
    grfrevyywdsyftmlglaesghwdkvadmvanfaheidtyghipngnrsyylsrsqppf
    falmvellaqhegdaalkqylpqmqkeyaywmdgvenlqagqqekrvvklqdgtllnryw
    ddrdtprpeswvediataksnpnrpateiyrdlrsaaasgwdfssrwmdnpqqlntlrtt
    sivpvdlnslmfkmekilaraskaagdnamanqyetlanarqkgiekylwndqqgwyady
    dlkshkvrnqltaaalfplyvnaaakdrankmatatkthllqpgglnttsvksgqqwdap
    ngwaplqwvateglqnygqkevamdiswhfltnvqhtydrekklvekydvsttgtggggg
    eyplqdgfgwtngvtlkmldlicpkeqpcdnvpatrptvksattqpstkeaqptp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jjbB (B:)
    vtpqppdillgplfndvqnaklfpdqktfadavpnsdplmiladyrmqqnqsgfdlrhfv
    nvnftlpkegqslrehidglwpvltrstentekwdsllplpepyvvpggrfrevyywdsy
    ftmlglaesghwdkvadmvanfaheidtyghipngnrsyylsrsqppffalmvellaqhe
    gdaalkqylpqmqkeyaywmdgvenlqagqqekrvvklqdgtllnrywddrdtprpeswv
    ediataksnpnrpateiyrdlrsaaasgwdfssrwmdnpqqlntlrttsivpvdlnslmf
    kmekilaraskaagdnamanqyetlanarqkgiekylwndqqgwyadydlkshkvrnqlt
    aaalfplyvnaaakdrankmatatkthllqpgglnttsvksgqqwdapngwaplqwvate
    glqnygqkevamdiswhfltnvqhtydrekklvekydvsttplqdgfgwtngvtlkmldl
    icpkeqpcdnvpa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2jjbC (C:)
    eetpvtpqppdillgplfndvqnaklfpdqktfadavpnsdplmiladyrmqqnqsgfdl
    rhfvnvnftlpkegekyvppegqslrehidglwpvltrstentekwdsllplpepyvvpg
    grfrevyywdsyftmlglaesghwdkvadmvanfaheidtyghipngnrsyylsrsqppf
    falmvellaqhegdaalkqylpqmqkeyaywmdgvenlqagqqekrvvklqdgtllnryw
    ddrdtprpeswvediataksnpnrpateiyrdlrsaaasgwdfssrwmdnpqqlntlrtt
    sivpvdlnslmfkmekilaraskaagdnamanqyetlanarqkgiekylwndqqgwyady
    dlkshkvrnqltaaalfplyvnaaakdrankmatatkthllqpgglnttsvksgqqwdap
    ngwaplqwvateglqnygqkevamdiswhfltnvqhtydrekklvekydvsttgtggggg
    eyplqdgfgwtngvtlkmldlicpkeqpcdnvpatrptvksattqpstkeaqptp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jjbC (C:)
    qppdillgplfndvqnaklfpdqktfadavpnsdplmiladyrmqqnqsgfdlrhfvnvn
    ftlpkegekyvppegqslrehidglwpvltrstentekwdsllplpepyvvpggrfrevy
    ywdsyftmlglaesghwdkvadmvanfaheidtyghipngnrsyylsrsqppffalmvel
    laqhegdaalkqylpqmqkeyaywmdgvenlqagqqekrvvklqdgtllnrywddrdtpr
    peswvediataksnpnrpateiyrdlrsaaasgwdfssrwmdnpqqlntlrttsivpvdl
    nslmfkmekilaraskaagdnamanqyetlanarqkgiekylwndqqgwyadydlkshkv
    rnqltaaalfplyvnaaakdrankmatatkthllqpgglnttsvksgqqwdapngwaplq
    wvateglqnygqkevamdiswhfltnvqhtydrekklvekydvsttyplqdgfgwtngvt
    lkmldlicpkeqpcdnvpat
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2jjbD (D:)
    eetpvtpqppdillgplfndvqnaklfpdqktfadavpnsdplmiladyrmqqnqsgfdl
    rhfvnvnftlpkegekyvppegqslrehidglwpvltrstentekwdsllplpepyvvpg
    grfrevyywdsyftmlglaesghwdkvadmvanfaheidtyghipngnrsyylsrsqppf
    falmvellaqhegdaalkqylpqmqkeyaywmdgvenlqagqqekrvvklqdgtllnryw
    ddrdtprpeswvediataksnpnrpateiyrdlrsaaasgwdfssrwmdnpqqlntlrtt
    sivpvdlnslmfkmekilaraskaagdnamanqyetlanarqkgiekylwndqqgwyady
    dlkshkvrnqltaaalfplyvnaaakdrankmatatkthllqpgglnttsvksgqqwdap
    ngwaplqwvateglqnygqkevamdiswhfltnvqhtydrekklvekydvsttgtggggg
    eyplqdgfgwtngvtlkmldlicpkeqpcdnvpatrptvksattqpstkeaqptp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jjbD (D:)
    vtpqppdillgplfndvqnaklfpdqktfadavpnsdplmiladyrmqqnqgfdlrhfvn
    vnftlpkkyvppegqslrehidglwpvltrstentekwdsllplpepyvvpggrfrevyy
    wdsyftmlglaesghwdkvadmvanfaheidtyghipngnrsyylsrsqppffalmvell
    aqhegdaalkqylpqmqkeyaywmdgvenlqagqqekrvvklqdgtllnrywddrdtprp
    eswvediataksnpnrpateiyrdlrsaaasgwdfssrwmdnpqqlntlrttsivpvdln
    slmfkmekilaraskaagdnamanqyetlanarqkgiekylwndqqgwyadydlkshkvr
    nqltaaalfplyvnaaakdrankmatatkthllqpgglnttsvksgqqwdapngwaplqw
    vateglqnygqkevamdiswhfltnvqhtydrekklvekydvsttyplqdgfgwtngvtl
    kmldlicpkeqpcdnvpatr